Clinisciences > KCNN2 antibody - C-terminal region
KCNN2 antibody - C-terminal region
Marca : Aviva Systems Biology
Richiedere ulteriori informazioni
Si prega di accedere per utilizzare questa funzione.
Datasheets/Manuals | Printable datasheet for anti-KCNN2 (ARP35094_T100) antibody |
---|
Publications | Chakroborty, S. et al. Early presynaptic and postsynaptic calcium signaling abnormalities mask underlying synaptic depression in presymptomatic Alzheimerâ, 8341-53 (2012). 226999141$s> |
---|---|
Tested Species Reactivity | Human, Rat, Monkey |
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish, Monkey |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 93% |
Peptide Sequence | Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-KCNN2 (ARP35094_T100) antibody is Catalog # AAP35094 (Previous Catalog # AAPP06325) |
Reference | Feranchak,A.P., et al., (2004) Gastroenterology 127 (3), 903-913 |
---|---|
Gene Symbol | KCNN2 |
Gene Full Name | Potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 |
Alias Symbols | SK2, hSK2, SKCA2, KCa2.2, SKCa 2 |
NCBI Gene Id | 3781 |
Protein Name | Small conductance calcium-activated potassium channel protein 2 |
Description of Target | Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes. |
Uniprot ID | Q9H2S1 |
Protein Accession # | NP_067627 |
Nucleotide Accession # | NM_021614 |
Protein Size (# AA) | 579 |
Molecular Weight | 64kDa |
Protein Interactions | SRPK2; SRPK1; UBC; ACTN2; KCNN2; CALM1; |
Protein interactions
Name | # of Products |
---|---|
ACTN2 | 90 |
CALM1 | 512 |
KCNN2 | 15 |
Biological pathways
Name | # of Products |
---|---|
Synaptic transmission | 454 |
Biological process
Name | # of Products |
---|---|
Ion transport | 453 |
Potassium ion transmembrane transport | 52 |
Potassium ion transport | 138 |
Synaptic transmission | 332 |
Cellular components
Name | # of Products |
---|---|
Integral to membrane | 2793 |
Plasma membrane | 2678 |
Protein function
Name | # of Products |
---|---|
Calmodulin binding | 222 |
Ion channel activity | 297 |
Potassium channel activity | 78 |
Small conductance calcium-activated potassium channel activity | 8 |
- KCNN2 Antibody - middle region (ARP35439_P050)Catalog #: ARP35439_P050Species Tested: Human, MonkeyApplication: IHC, WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- KCNN2 Antibody (Asp244) (OASG04059)Catalog #: OASG04059Application: WB, IHCFormat: Liquid. PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.Size: 100 uL
- KCNN2 ELISA Kit (Human) (OKDD00355)Catalog #: OKDD00355Application: ELISAKit Range: 0.156-10ng/mLSensitivity: < 0.081 ng/mLSize: 96 Wells