NGRN (FI58G, Neugrin, Mesenchymal Stem Cell Protein DSC92, Neurite Outgrowth-associated Protein, Spinal Cord-derived Protein FI58G)
Cat# 130355-50ug
Size : 50ug
Marca : US Biological
130355 Rabbit Anti-NGRN (FI58G, Neugrin, Mesenchymal Stem Cell Protein DSC92, Neurite Outgrowth-associated Protein, Spinal Cord-derived Protein FI58G)
Clone Type
PolyclonalHost
mouseSource
humanIsotype
IgGGrade
Affinity PurifiedApplications
WBCrossreactivity
HuAccession #
BC001682, AAH01682.1Shipping Temp
Blue IceStorage Temp
-20°CNGRN may be involved in neuronal differentiation.||Applications:|Suitable for use in Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|MEAPGAPPRTLTWEAMEQIRYLHEEFPESWSVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLKQDQKVLKKAGLAHSLQHLRGSGNTSKLLPAGHSVSGSLLMPGHEASSKDPNHSTALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPSGQKLEELKAEEPDNFSSKVVQRGREFFDSNGNFLYRI||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.