Prdm4 Antibody - C-terminal region : FITC

Cat# ARP31516_P050-FITC

Size : 100ul

Marca : Aviva Systems Biology

Richiedere ulteriori informazioni

Contatta il distributore locale :


Telefono : +1 850 650 7790

Prdm4 Antibody - C-terminal region (ARP31516_P050)

Datasheets/ManualsPrintable datasheet for anti-Prdm4 (ARP31516_P050) antibody
Product Info
Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Prdm4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 100%; Yeast: 92%
Peptide SequenceSynthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS
Concentration0.5 mg/ml
Blocking PeptideFor anti-Prdm4 (ARP31516_P050) antibody is Catalog # AAP31516
Gene SymbolPrdm4
Gene Full NamePR domain containing 4
Alias SymbolsSC, SC-, SC1, SC-1, AW552272, 1700031E19Rik, 2810470D21Rik
NCBI Gene Id72843
Protein NamePR domain zinc finger protein 4
Description of TargetPrdm4 may function as a transcription factor involved in cell differentiation.
Uniprot IDQ80V63
Protein Accession #NP_857633
Nucleotide Accession #NM_181650
Protein Size (# AA)803
Molecular Weight88kDa