Small Heat Shock Protein ibpA, Recombinant, Yersinia pestis bv. Antiqua, aa1-137, His-Tag
Cat# 586359-100ug
Size : 100ug
Marca : US Biological
586359 Small Heat Shock Protein ibpA, Recombinant, Yersinia pestis bv. Antiqua, aa1-137, His-Tag
Clone Type
PolyclonalSwiss Prot
Q1CD74Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CAssociates with aggregated proteins, together with IbpB, to stabilize and protect them from irreversible denaturation and extensive proteolysis during heat shock and oxidative stress. Aggregated proteins bound to the IbpAB complex are more efficiently refolded and reactivated by the ATP-dependent chaperone systems ClpB and DnaK/DnaJ/GrpE. Its activity is ATP-independent.||Source:|Recombinant protein corresponding to aa1-137 from Yersinia pestis bv. Antiqua Small heat shock protein ibpA, fused to 6X His-Tag at N-terminal, expressed in E.coli.||Molecular Weight: |~21.6kD||Amino Acid Sequence:|MRNSDLAPLYRSAIGFDRLFNLLESGQNQSNGGYPPYNVELVDENNYRIAIAVAGFAEQELEITTQDNLLIVRGSHANEPAQRTYLYQGIAERNFERKFQLAEHIKIKGANLVNGLLYIDLERLVPESLKPRRIEIK||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.