TNFSF8 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
- More Files
- Specifications
Product Description
Human TNFSF8 full-length ORF ( NP_001235.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
52.4
Interspecies Antigen Sequence
Mouse (70)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — TNFSF8
Entrez GeneID
944GeneBank Accession#
NM_001244.2Protein Accession#
NP_001235.1Gene Name
TNFSF8
Gene Alias
CD153, CD30L, CD30LG, MGC138144
Gene Description
tumor necrosis factor (ligand) superfamily, member 8
Omim ID
603875Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. [provided by RefSeq
Other Designations
CD153 antigen|CD30 antigen ligand|CD30 ligand|OTTHUMP00000022762
- Interactomes
- Pathways
- Diseases