C2orf33 Antibody - C-terminal region : Biotin
Referentie ARP49483_P050-Biotin
Formaat : 100ul
Merk : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-MFF (ARP49483_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf33 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 83%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-MFF (ARP49483_P050) antibody is Catalog # AAP49483 (Previous Catalog # AAPS25106) |
Reference | Gregory,S.G., (2008) Mol. Biol. Cell 19 (6), 2402-2412 |
---|---|
Gene Symbol | MFF |
Gene Full Name | Mitochondrial fission factor |
Alias Symbols | EMPF2, GL004, C2orf33 |
NCBI Gene Id | 56947 |
Protein Name | Mitochondrial fission factor |
Description of Target | The exact function of C2orf33 remains unknown. |
Uniprot ID | Q9GZY8 |
Protein Accession # | NP_064579 |
Nucleotide Accession # | NM_020194 |
Protein Size (# AA) | 342 |
Molecular Weight | 38kDa |
Protein Interactions | MFF; DNM1L; YWHAQ; UBC; DDX28; ILF3; |