DDX19B Antibody - C-terminal region
Referentie ARP40299_T100-25UL
Formaat : 25ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
DDX19B Antibody - C-terminal region (ARP40299_T100)
| Datasheets/Manuals | Printable datasheet for anti-DDX19B (ARP40299_T100) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human DDX19B |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 79%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTG |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-DDX19B (ARP40299_T100) antibody is Catalog # AAP40299 (Previous Catalog # AAPP22805) |
| Sample Type Confirmation | DDX19B is supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Yin,L., Reprod. Fertil. Dev. 14 (3-4), 185-189 (2002) |
|---|---|
| Gene Symbol | DDX19B |
| Gene Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 19B |
| Alias Symbols | DBP5, RNAh, DDX19 |
| NCBI Gene Id | 11269 |
| Protein Name | ATP-dependent RNA helicase DDX19B |
| Description of Target | DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX19B is a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Uniprot ID | Q9UMR2 |
| Protein Accession # | NP_009173 |
| Nucleotide Accession # | NM_007242 |
| Protein Size (# AA) | 479 |
| Molecular Weight | 53kDa |
| Protein Interactions | MIF4GD; UBC; CTBP2; AICDA; APP; COPS5; POT1; TERF1; tat; IKBKG; RAE1; RWDD2B; XPO7; B3GALT4; SKP1; PRPSAP1; GNB2L1; DCK; NUP214; KLHDC2; |
