ELOC Antibody - middle region : HRP

Referentie P100962_T100-HRP

Formaat : 100ul

Merk : Aviva Systems Biology

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

ELOC Antibody - middle region (P100962_T100)

Datasheets/ManualsPrintable datasheet for anti-ELOC (P100962_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Dog, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TCEB1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Human: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: AENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALE
Concentration1.0 mg/ml
Blocking PeptideFor anti-ELOC (P100962_T100) antibody is Catalog # AAP31320 (Previous Catalog # AAPP02070)
Sample Type Confirmation

TCEB1 is supported by BioGPS gene expression data to be expressed in Jurkat

ReferenceYu,X., et al., (2003) Science 302 (5647), 1056-1060
Gene SymbolELOC
Gene Full Nameelongin C
Alias SymbolsSIII, TCEB1
NCBI Gene Id6921
Protein Nameelongin-C
Description of TargetThis gene encodes the protein elongin C, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Multiple alternatively spliced transcript variants encoding two distinct isoforms have been identified.
Uniprot IDQ15369
Protein Accession #NP_005639
Nucleotide Accession #NM_005648
Protein Size (# AA)112
Molecular Weight12kDa
Protein InteractionsUBC; TCEB2; FUS; vif; METTL21C; SOCS4; CUL5; PRAME; POP1; MDM2; VHL; ASB18; ASB12; ASB14; ASB15; ASB9; ASB8; ASB7; ASB5; ASB10; ASB16; ASB13; ASB1; ASB3; APEX1; CUL2; Zswim8; ASB2; CPTP; CBX5; MRAS; JTB; RCAN2; SOCS1; CUL3; WNT7B; NEDD8; HIF1A; EFNB3; CYP