FGF10 Recombinant Protein (Human)
Referentie OPCA04596-100UG
Formaat : 100ug
Merk : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for FGF10 Recombinant Protein (Human) (OPCA04596) (OPCA04596) |
---|
Predicted Species Reactivity | Homo sapiens|Human |
---|---|
Product Format | Liquid or Lyophilized powder |
Additional Information | Species Specificity Detail: Homo sapiens (Human) |
Reconstitution and Storage | -20°C or -80°C |
Formulation | Tris-base, 50% glycerol |
Purity | Greater than 90% as determined by SDS-PAGE. |
Peptide Sequence | GQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
Protein Sequence | GQDMVSPEATNSSSSSFSSPSSAGRHVRSYNHLQGDVRWRKLFSFTKYFLKIEKNGKVSGTKKENCPYSILEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMVVHS |
Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Source | E.coli |
Protein Range | 41-208 aa |
Tag | N-terminal 6xHis-SUMO-tagged |
Reference | LADD syndrome is caused by FGF10 mutations.Milunsky J.M., Zhao G., Maher T.A., Colby R., Everman D.B.Clin. Genet. 69:349-354(2006) |
---|---|
Gene Symbol | FGF10 |
Gene Full Name | fibroblast growth factor 10 |
Alias Symbols | FGF-10;fibroblast growth factor 10;keratinocyte growth factor 2;produced by fibroblasts of urinary bladder lamina propria. |
NCBI Gene Id | 2255 |
Protein Name | Fibroblast growth factor 10 |
Description of Target | Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. May play a role in wound healing. |
Uniprot ID | O15520 |
Protein Accession # | NP_004456 |
Nucleotide Accession # | NM_004465 |
Protein Size (# AA) | Recombinant |
Molecular Weight | 35 kDa |