HSD3B1 Antibody - N-terminal region : Biotin
Referentie ARP41821_P050-Biotin
Formaat : 100ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
HSD3B1 Antibody - N-terminal region (ARP41821_P050)
| Datasheets/Manuals | Printable datasheet for anti-HSD3B1 (ARP41821_P050) antibody |
|---|
| Publications | Dual targeting of androgen receptor and mTORC1 by salinomycin in prostate cancer. Oncotarget. 7, 62240-62254 (2016). 27557496 |
|---|---|
| Tested Species Reactivity | Human, Monkey |
| Predicted Species Reactivity | Human, Goat, Monkey |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human HSD3B1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Goat: 82%; Human: 100%; Monkey: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-HSD3B1 (ARP41821_P050) antibody is Catalog # AAP41821 (Previous Catalog # AAPP10869) |
| Reference | Ross,R.W., (2008) J. Clin. Oncol. 26 (6), 842-847 |
|---|---|
| Gene Symbol | HSD3B1 |
| Gene Full Name | Hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 |
| Alias Symbols | HSD3B, HSDB3, HSDB3A, SDR11E1, 3BETAHSD |
| NCBI Gene Id | 3283 |
| Protein Name | 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1 |
| Description of Target | 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids. |
| Uniprot ID | P14060 |
| Protein Accession # | NP_000853 |
| Nucleotide Accession # | NM_000862 |
| Protein Size (# AA) | 373 |
| Molecular Weight | 42kDa |
