Mta2 Antibody - N-terminal region : HRP
Referentie ARP37167_T100-HRP
Formaat : 100ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
Mta2 Antibody - N-terminal region (ARP37167_T100)
| Datasheets/Manuals | Printable datasheet for anti-Mta2 (ARP37167_T100) antibody |
|---|
| Tested Species Reactivity | Mouse |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Purification | Protein A purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 93%; Horse: 100%; Human: 93%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 77% |
| Peptide Sequence | Synthetic peptide located within the following region: YSLVFDPVQKTLLADQGEIRVGCKFQAEIPDRLAEGESDNRNQQKMEMKV |
| Concentration | 1.0 mg/ml |
| Blocking Peptide | For anti-Mta2 (ARP37167_T100) antibody is Catalog # AAP37167 (Previous Catalog # AAPP10730) |
| Reference | Blackshaw,S., PLoS Biol. 2 (9), E247 (2004) |
|---|---|
| Gene Symbol | Mta2 |
| Gene Full Name | Metastasis-associated gene family, member 2 |
| Alias Symbols | Mta1, mmta, mmta2, Mta1l1, Mata1l1, AW550797 |
| NCBI Gene Id | 23942 |
| Protein Name | Metastasis-associated protein MTA2 |
| Description of Target | MTA2 modulates the enzymatic activity of the histone deacetylase core complex. |
| Uniprot ID | Q9R190 |
| Protein Accession # | NP_035972 |
| Nucleotide Accession # | NM_011842 |
| Protein Size (# AA) | 668 |
| Molecular Weight | 73kDa |
| Protein Interactions | Eed; Nanog; L3mbtl2; Hdac1; Mta1; Satb2; Pou5f1; Runx1; RBBP7; RBBP4; Chd4; Mta2; Mbd3; Mbd2; Hdac2; Gata1; Sall4; Tfcp2l1; Esrrb; Zfpm1; |
