MUC5AC (Mucin 5AC, Oligomeric Mucus/gel-Forming, MUC5) (MaxLight 490)
Referentie 249029-ML490-100ul
Formaat : 100ul
Merk : US Biological
249029-ML490 Rabbit Anti-MUC5AC (Mucin 5AC, Oligomeric Mucus/gel-Forming, MUC5) (MaxLight 490)
Clone Type
PolyclonalHost
mouseIsotype
IgG2b,kGrade
PurifiedApplications
FLISA WBAccession #
XP_495860Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeMaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.||Mouse monoclonal antibody raised against a partial recombinant MUC5AC.||Applications: |Suitable for use in Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap. ||Note: Applications are based on unconjugated antibody.