NT5C3 antibody - middle region
Referentie ARP32185_P050
Formaat : 100ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
| Datasheets/Manuals | Printable datasheet for anti-NT5C3A (ARP32185_P050) antibody |
|---|
| Publications | The intracellular pyrimidine 5'-nucleotidase NT5C3A is a negative epigenetic factor in interferon and cytokine signaling. Sci Signal. 11, (2018). 29463777 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NT5C3 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 85%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Zebrafish: 92% |
| Peptide Sequence | Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-NT5C3A (ARP32185_P050) antibody is Catalog # AAP32185 (Previous Catalog # AAPP03158) |
| Reference | Amici,A., et al., (2002) Genomics Meth. Enzymol. 354,149-159 |
|---|---|
| Gene Symbol | NT5C3A |
| Gene Full Name | 5'-nucleotidase, cytosolic III |
| Alias Symbols | p36, PN-I, POMP, PSN1, UMPH, NT5C3, P5N-1, UMPH1, hUMP1, P5'N-1, cN-III |
| NCBI Gene Id | 51251 |
| Protein Name | Cytosolic 5'-nucleotidase 3 |
| Description of Target | Pyrimidine 5-prime-nucleotidase (P5N), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology. Pyrimidine 5-prime-nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2; MIM 191720). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | Q9H0P0-1 |
| Protein Accession # | NP_057573 |
| Nucleotide Accession # | NM_016489 |
| Protein Size (# AA) | 336 |
| Molecular Weight | 38kDa |
| Protein Interactions | BAG3; VANGL1; NDUFAB1; GNAQ; UBC; |
-
What is the species homology for "NT5C3 Antibody - middle region (ARP32185_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".
-
How long will it take to receive "NT5C3 Antibody - middle region (ARP32185_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "NT5C3 Antibody - middle region (ARP32185_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "NT5C3 Antibody - middle region (ARP32185_P050)"?
This target may also be called "p36, PN-I, POMP, PSN1, UMPH, NT5C3, P5N-1, UMPH1, hUMP1, P5'N-1, cN-III" in publications.
-
What is the shipping cost for "NT5C3 Antibody - middle region (ARP32185_P050)"?
The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.
-
What is the guarantee for "NT5C3 Antibody - middle region (ARP32185_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "NT5C3 Antibody - middle region (ARP32185_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "38kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "NT5C3 Antibody - middle region (ARP32185_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "NT5C3A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "NT5C3A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "NT5C3A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "NT5C3A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "NT5C3A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "NT5C3A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.