PAX2 Antibody - middle region : Biotin
Referentie P100859_T100-Biotin
Formaat : 100ul
Merk : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-PAX2 (P100859_T100) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PAX2 |
Purification | Protein A purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100% |
Peptide Sequence | Synthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS |
Concentration | 1.0 mg/ml |
Blocking Peptide | For anti-PAX2 (P100859_T100) antibody is Catalog # AAP31220 (Previous Catalog # AAPP01965) |
Reference | Muratovska, A., et al., (2003) Oncogene 22 (39), 7989-7997. |
---|---|
Gene Symbol | PAX2 |
Gene Full Name | Paired box 2 |
Alias Symbols | FSGS7, PAPRS |
NCBI Gene Id | 5076 |
Protein Name | Paired box protein Pax-2 |
Description of Target | PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. |
Uniprot ID | Q02962 |
Protein Accession # | NP_003979 |
Nucleotide Accession # | NM_003988 |
Protein Size (# AA) | 417 |
Molecular Weight | 45kDa |
Protein Interactions | BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2; |