Prdm4 Antibody - C-terminal region : FITC
Referentie ARP31516_P050-FITC
Formaat : 100ul
Merk : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-Prdm4 (ARP31516_P050) antibody |
---|
Tested Species Reactivity | Mouse |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Prdm4 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 93%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 100%; Rat: 100%; Yeast: 92% |
Peptide Sequence | Synthetic peptide located within the following region: HLKTCKEPSSSSSAQEEEDDESEEEDLADSMRTEDCRMGSAVYSTDESLS |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-Prdm4 (ARP31516_P050) antibody is Catalog # AAP31516 |
Gene Symbol | Prdm4 |
---|---|
Gene Full Name | PR domain containing 4 |
Alias Symbols | SC, SC-, SC1, SC-1, AW552272, 1700031E19Rik, 2810470D21Rik |
NCBI Gene Id | 72843 |
Protein Name | PR domain zinc finger protein 4 |
Description of Target | Prdm4 may function as a transcription factor involved in cell differentiation. |
Uniprot ID | Q80V63 |
Protein Accession # | NP_857633 |
Nucleotide Accession # | NM_181650 |
Protein Size (# AA) | 803 |
Molecular Weight | 88kDa |