PRKDC (DNA-dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, HYRC, HYRC1) (HRP)

Referentie 131815-HRP-100ul

Formaat : 100ul

Merk : US Biological

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790


131815-HRP Rabbit Anti-PRKDC (DNA-dependent Protein Kinase Catalytic Subunit, DNA-PK Catalytic Subunit, DNA-PKcs, DNPK1, p460, HYRC, HYRC1) (HRP)

Clone Type
Polyclonal
Host
mouse
Source
human
Isotype
IgG
Grade
Affinity Purified
Applications
E IHC WB
Crossreactivity
Hu
Accession #
NM_006904, NP_008835
Shipping Temp
Blue Ice
Storage Temp
-20°C

The PRKDC gene encodes the catalytic subunit of a nuclear DNA-dependent serine/threonine protein kinase (DNA-PK). The second component is the autoimmune antigen Ku (MIM 152690), which is encoded by the G22P1 gene on chromosome 22q. On its own, the catalytic subunit of DNA-PK is inactive and relies on the G22P1 component to direct it to the DNA and trigger its kinase activity; PRKDC must be bound to DNA to express its catalytic properties.[supplied by OMIM]||Applications:|Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.||Recommended Dilution:|Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml|Optimal dilutions to be determined by the researcher.||AA Sequence:|KMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVITCDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM||Storage and Stability:|Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C. Aliquots are stable at -20°C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.||Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG|Clone No: 1B9|Host: mouse|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa4019-4129, from human PRKDC (NP_008835) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human PRKDC.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa4019-4129, from human PRKDC (NP_008835) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PRKDC.