PSMD4 antibody - N-terminal region

Referentie ARP32342_T100

Formaat : 100ul

Merk : Aviva Systems Biology

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-PSMD4 (ARP32342_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PSMD4
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 79%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: VAHLALKHRQGKNHKMRIIAFVGSPVEDNEKDLVKLAKRLKKEKVNVDII
Concentration1.0 mg/ml
Blocking PeptideFor anti-PSMD4 (ARP32342_T100) antibody is Catalog # AAP32342 (Previous Catalog # AAPP03331)
Sample Type Confirmation

PSMD4 is strongly supported by BioGPS gene expression data to be expressed in Raji

Subunit4
ReferenceWang,Q., (2005) J Mol Biol. 348(3), 727-39
Gene SymbolPSMD4
Gene Full NameProteasome (prosome, macropain) 26S subunit, non-ATPase, 4
Alias SymbolsAF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5
NCBI Gene Id5710
Protein Name26S proteasome non-ATPase regulatory subunit 4
Description of TargetPSMD4 encodes one of the non-ATPase subunits of the 19S regulator lid which is part of a multicatalytic proteinase complex of the 26S proteasome.
Uniprot IDP55036
Protein Accession #NP_002801
Nucleotide Accession #NM_002810
Protein Size (# AA)377
Molecular Weight41kDa
Protein InteractionsUBC; cdc20; XPC; SPRTN; PSMD14; MDM2; PSMC2; PSMA1; ADRM1; UBQLN1; TXNL1; PSMD3; PSMD2; PSMD1; PSMC6; PSMC4; PSMC1; UCHL5; RPS12; PSMD8; UBQLN4; VCP; GJA1; DIO2; SCHIP1; FBXO6; PARK2; UL76; FBXO25; LOC100044627; Gm4705; LOC677113; Rps6-ps4; Rpl34-ps1; Rpl
  1. What is the species homology for "PSMD4 Antibody - N-terminal region (ARP32342_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Yeast, Zebrafish".

  2. How long will it take to receive "PSMD4 Antibody - N-terminal region (ARP32342_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "PSMD4 Antibody - N-terminal region (ARP32342_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "PSMD4 Antibody - N-terminal region (ARP32342_T100)"?

    This target may also be called "AF, ASF, S5A, AF-1, MCB1, Rpn10, pUB-R5" in publications.

  5. What is the shipping cost for "PSMD4 Antibody - N-terminal region (ARP32342_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "PSMD4 Antibody - N-terminal region (ARP32342_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "PSMD4 Antibody - N-terminal region (ARP32342_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "PSMD4 Antibody - N-terminal region (ARP32342_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "PSMD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "PSMD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "PSMD4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "PSMD4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "PSMD4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "PSMD4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.