Clinisciences > PTDSS2 antibody - N-terminal region
PTDSS2 antibody - N-terminal region
Referentie ARP49960_P050
Formaat : 100ul
Merk : Aviva Systems Biology
Meer informatie aanvragen
Log alstublieft in om deze functie te gebruiken.
Bulk
Order
Order
Aviva's
Satisfaction
Guarantee
Satisfaction
Guarantee
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- : Antibody & Protein in US
- + /Kit in US
- Contact us for international orders.
PTDSS2 Antibody - N-terminal region (ARP49960_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/Manuals | Printable datasheet for anti-PTDSS2 (ARP49960_P050) antibody |
---|
Publications | Deficient Endoplasmic Reticulum-Mitochondrial Phosphatidylserine Transfer Causes Liver Disease. Cell. 177, 881-895.e17 (2019). 310511061$s> |
---|---|
Tested Species Reactivity | Human |
Predicted Species Reactivity | Human, Mouse, Rat, Dog, Guinea Pig, Horse |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PTDSS2 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: GQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEE |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-PTDSS2 (ARP49960_P050) antibody is Catalog # AAP49960 (Previous Catalog # AAPP44252) |
Sample Type Confirmation | PTDSS2 is supported by BioGPS gene expression data to be expressed in HEK293T |
Gene Symbol | PTDSS2 |
---|---|
Gene Full Name | Phosphatidylserine synthase 2 |
Alias Symbols | PSS2 |
NCBI Gene Id | 81490 |
Protein Name | Phosphatidylserine synthase 2 |
Description of Target | Phosphatidylserine (PS) accounts for 5 to 10% of cell membrane phospholipids. In addition to its role as a structural component, PS is involved in cell signaling, blood coagulation, and apoptosis. PS is synthesized by a calcium-dependent base-exchange reaction catalyzed by PS synthases (EC 2.7.8.8), like PTDSS2, that exchange L-serine for the polar head group of phosphatidylcholine (PC) or phosphatidylethanolamine (PE) (Sturbois-Balcerzak et al., 2001 [PubMed 11084049]). |
Uniprot ID | Q9BVG9 |
Protein Accession # | NP_110410 |
Nucleotide Accession # | NM_030783 |
Protein Size (# AA) | 487 |
Molecular Weight | 56kDa |
Protein Interactions | HNRNPR; ILF3; UBC; |
Biological process
Name | # of Products |
---|---|
Phosphatidylserine biosynthetic process | 3 |
Phospholipid biosynthetic process | 39 |
Cellular components
Name | # of Products |
---|---|
Endoplasmic reticulum membrane | 498 |
Integral to membrane | 2793 |
Intracellular | 1678 |
Membrane | 2769 |
Protein function
Name | # of Products |
---|---|
CDP-diacylglycerol-serine O-phosphatidyltransferase activity | 2 |
Transferase activity | 1042 |
- PTDSS2 Antibody - middle region (ARP49961_P050)Catalog #: ARP49961_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.