RBPMS antibody - N-terminal region

Referentie ARP40269_T100

Formaat : 100ul

Merk : Aviva Systems Biology

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

RBPMS Antibody - N-terminal region (ARP40269_T100)

Datasheets/ManualsPrintable datasheet for anti-RBPMS (ARP40269_T100) antibody
Product Info
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB, ICC
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RBPMS
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: LFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQ
Concentration1.0 mg/ml
Blocking PeptideFor anti-RBPMS (ARP40269_T100) antibody is Catalog # AAP40269 (Previous Catalog # AAPP23471)
ReferenceRual,J.F., (2005) Nature 437 (7062), 1173-1178
Gene SymbolRBPMS
Gene Full NameRNA binding protein with multiple splicing
Alias SymbolsHERMES
NCBI Gene Id11030
Protein NameRNA binding protein with multiple splicing EMBL AAH92476.1
Description of TargetRBPMS is a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. RBPMS has a single, putative RRM domain in its N-terminus.This gene encodes a member of the RRM family of RNA-binding proteins. The RRM domain is between 80-100 amino acids in length and family members contain one to four copies of the domain. The RRM domain consists of two short stretches of conserved sequence called RNP1 and RNP2, as well as a few highly conserved hydrophobic residues. The protein encoded by this gene has a single, putative RRM domain in its N-terminus. Alternative splicing results in multiple transcript variants encoding different isoforms.
Uniprot IDQ93062
Protein Accession #NP_001008712
Nucleotide Accession #NM_001008712
Protein Size (# AA)219
Molecular Weight24kDa
Protein InteractionsCRBN; ILF3; DOK6; ZNF385C; TEX37; WDR90; PAPD4; TOR1AIP2; ATP6V0E2; SH3RF2; DCDC2B; LOC148413; MGAT5B; SPATA8; RDH12; LOC142937; GLYCTK; NEU4; C22orf39; LRRC75A-AS1; PRR20A; ZNF488; DTX2; NAPRT; HNRNPLL; RIPPLY1; LONRF1; FBF1; C1orf94; ZC3H10; C9orf24; LI