Recombinant Mouse C-X-C Motif Chemokine 9/CXCL9

Referentie 32-8864-10

Formaat : 10µg

Merk : Abeomics

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

Recombinant Mouse C-X-C Motif Chemokine 9/CXCL9(Discontinued)


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM Tris,200mM NaCl,pH8.3
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MTLVIRNARCSCISTSRGTVHYKSLKDLKQFAPSPNCNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKKINQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Gene : Cxcl9
Gene ID : 17329
Uniprot ID : P18340
Source: E.coli.
MW :12.3kD.
Recombinant Mouse Fibroblast growth factor 9 is produced by our E.coli expression system and the target gene encoding Met1­Ser208 is expressed with a 8his tag at the C-terminus. Chemokine (C-X-C motif) ligand 9 (CXCL9, MIG), is a small cytokine belonging to the CXC chemokine family. CXCL9 functions as one of the three ligands of chemokine receptor CXCR3 which is a G protein-coupled receptor found predominantly on T cells. It together with CXCL10 and CXCL11, may activate CXCR3 by binding to it. CXCL9 serves as a cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. It has been observed that tumour endothelial cells secrete high levels of CXCL9 in all, and CXCL10 in most melanoma metastases. it plays an important role in CD4+ T lymphocyte recruitment and development of CAV, MOMA-2+ macrophages are the predominant recipient-derived source of CXCL9, and recipient CD4 lymphocytes are necessary for sustained CXCL9 production and CAV development in this model.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
There are currently no product reviews