Reagentia en instrumenten voor immunologie, celbiologie en moleculaire biologie.
 
> REPIN1 antibody - middle region

REPIN1 antibody - middle region

Afdrukken Afdrukken
Log in alstublieft

Referentie ARP31916_P050

Formaat : 100ul

Merk : Aviva Systems Biology

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-REPIN1 (ARP31916_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human REPIN1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 80%
Peptide SequenceSynthetic peptide located within the following region: GNCGRSFAQWDQLVAHKRVHVAEALEEAAAKALGPRPRGRPAVTAPRPGG
Concentration0.5 mg/ml
Blocking PeptideFor anti-REPIN1 (ARP31916_P050) antibody is Catalog # AAP31916 (Previous Catalog # AAPS08410)
ReferenceKim,M.Y., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (35), 13074-13079
Gene SymbolREPIN1
Gene Full NameReplication initiator 1
Alias SymbolsAP4, RIP60, ZNF464, Zfp464
NCBI Gene Id29803
Protein NameReplication initiator 1
Description of TargetSequence-specific double-stranded DNA-binding protein required for initiation of chromosomal DNA replication. REPIN1 binds on 5'-ATT-3' reiterated sequences downstream of the origin of bidirectional replication (OBR) and a second, homologous ATT sequence of opposite orientation situated within the OBR zone. REPIN1 facilitates DNA bending.
Uniprot IDQ9BWE0
Protein Accession #NP_037532
Nucleotide Accession #NM_013400
Protein Size (# AA)567
Molecular Weight63kDa
Protein InteractionsUBC; NEDD8; SUMO1; SUZ12; RNF2; BMI1; NEK9; MYCBP; POLA2; HGS; Dlg4; TERF2; GATA3; HDAC2; HDAC1; GMNN; HDAC3;
Protein interactions
Name# of Products
GATA352
GMNN73
HDAC1928
HDAC2549
HDAC3422
TERF2313
Biological pathways
Name# of Products
DNA replication225
Biological process
Name# of Products
DNA replication134
Cellular components
Name# of Products
Intracellular1678
Nuclear origin of replication recognition complex6
Nucleus4914
Protein function
Name# of Products
DNA binding3958
Metal ion binding5514
Zinc ion binding3721

  1. What is the species homology for "REPIN1 Antibody - middle region (ARP31916_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Rabbit, Yeast".

  2. How long will it take to receive "REPIN1 Antibody - middle region (ARP31916_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "REPIN1 Antibody - middle region (ARP31916_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "REPIN1 Antibody - middle region (ARP31916_P050)"?

    This target may also be called "AP4, RIP60, ZNF464, Zfp464" in publications.

  5. What is the shipping cost for "REPIN1 Antibody - middle region (ARP31916_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "REPIN1 Antibody - middle region (ARP31916_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "REPIN1 Antibody - middle region (ARP31916_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "63kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "REPIN1 Antibody - middle region (ARP31916_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "REPIN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "REPIN1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "REPIN1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "REPIN1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "REPIN1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "REPIN1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.