RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8)

Referentie 375151-100ug

Formaat : 100ug

Merk : US Biological

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790


375151 RpsH, Recombinant, E. coli, aa2-130, His-Tag (30S Ribosomal Protein S8)

Clone Type
Polyclonal
Swiss Prot
P0A7W7
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C

One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit. Protein S8 is a translational repressor protein, it controls the translation of the spc operon by binding to its mRNA.||Source:|Recombinant protein corresponding to aa2-130 from E. coli rpsH, fused to His-Tag at N-terminal, expressed in E. coli. ||Molecular Weight: |~18.0kD||Amino Acid Sequence:|SMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGEIICYVA||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.

Applications
Source: Recombinant, E. coli|Purity: ≥90% (SDS-PAGE)|Concentration: As Reported |Form: Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a liquid in Tris-HCl, pH 8.0, 1mM EDTA, 50% glycerol.
Purity
≥90% (SDS-PAGE)
References
1. Structures of the bacterial ribosome at 3.5 A resolution. Schuwirth B.S., Borovinskaya M.A., Hau C.W., Zhang W., Vila-Sanjurjo A., Holton J.M., Cate J.H.D.Science 310:827-834(2005).