SCMH1 Antibody - middle region
Referentie ARP31693_P050-25UL
Formaat : 25ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
SCMH1 Antibody - middle region (ARP31693_P050)
| Datasheets/Manuals | Printable datasheet for anti-SCMH1 (ARP31693_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Horse, Rabbit, Yeast |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SCMH1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 86%; Yeast: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: LTGDNLQPPGTKVVIPKNPYPASDVNTEKPSIHSSTKTVLEHQPGQRGRK |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SCMH1 (ARP31693_P050) antibody is Catalog # AAP31693 (Previous Catalog # AAPP02480) |
| Reference | Olsen,J.V., (2006) Cell 127 (3), 635-648 |
|---|---|
| Gene Symbol | SCMH1 |
| Gene Full Name | Sex comb on midleg homolog 1 (Drosophila) |
| Alias Symbols | Scml3 |
| NCBI Gene Id | 22955 |
| Protein Name | Polycomb protein SCMH1 |
| Description of Target | SCMH1 is a component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. |
| Uniprot ID | Q96GD3-4 |
| Protein Accession # | NP_036368 |
| Nucleotide Accession # | NM_012236 |
| Protein Size (# AA) | 591 |
| Molecular Weight | 65kDa |
| Protein Interactions | UBQLN1; RNF2; MAGEA12; BMI1; UBQLN4; PHC3; CBX4; PCGF2; PHC2; PHC1; MAML3; LZTR1; PCBD1; EWSR1; TMEM11; SCMH1; MOB4; TOB1; POLR2M; LYPLA2; GMNN; HK1; Cbx2; |
