Small integral membrane protein 6 (SMIM6) (NM_001162997) Human Recombinant Protein

CAT#: TP328023L

Recombinant protein of human hypothetical protein LOC100130933 (LOC100130933), 1 mg

Size: 20 ug 100 ug 1 mg


Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

Product Images

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC228023 representing NM_001162997
Red=Cloning site Green=Tags(s)

MDQLVFKETIWNDAFWQNPWDQGGLAVIILFITAVLLLILFAIVFGLLTSTENTQCEAGEEE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 6.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001156469
Locus ID 100130933
UniProt ID P0DI80
Cytogenetics 17q25.1
Refseq ORF 186
Synonyms C17orf110; ELN

Documents