TBX6 antibody - N-terminal region

Referentie ARP33405_P050

Formaat : 100ul

Merk : Aviva Systems Biology

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-TBX6 (ARP33405_P050) antibody
Product Info
Publications

Chen, Y.-L. et al. Smad6 inhibits the transcriptional activity of Tbx6 by mediating its degradation. J. Biol. Chem. 284, 23481-90 (2009). 1956107518772864

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human TBX6
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: AHPPLPLLPPAMGTEPAPSAPEALHSLPGVSLSLENRELWKEFSSVGTEM
Concentration0.5 mg/ml
Blocking PeptideFor anti-TBX6 (ARP33405_P050) antibody is Catalog # AAP33405 (Previous Catalog # AAPP04451)
ReferencePapapetrou,C., et al., (1999) Genomics 55 (2), 238-241
Gene SymbolTBX6
Gene Full NameT-box 6
Alias SymbolsSCDO5
NCBI Gene Id6911
Protein NameT-box transcription factor TBX6
Description of TargetThe TBX6 gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. TBX6 is the human ortholog of mouse Tbx6. Knockout experiments in mice indicate that Tbx6 is important for specification of paraxial mesoderm structures.
Uniprot IDO95947
Protein Accession #NP_004599
Nucleotide Accession #NM_004608
Protein Size (# AA)436
Molecular Weight47kDa
Protein InteractionsHSFY1; C1orf94; RBPMS; TOX4; PSMA3; MEOX2; PRMT1;
  1. What is the species homology for "TBX6 Antibody - N-terminal region (ARP33405_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig".

  2. How long will it take to receive "TBX6 Antibody - N-terminal region (ARP33405_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TBX6 Antibody - N-terminal region (ARP33405_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TBX6 Antibody - N-terminal region (ARP33405_P050)"?

    This target may also be called "SCDO5" in publications.

  5. What is the shipping cost for "TBX6 Antibody - N-terminal region (ARP33405_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "TBX6 Antibody - N-terminal region (ARP33405_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TBX6 Antibody - N-terminal region (ARP33405_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TBX6 Antibody - N-terminal region (ARP33405_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TBX6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TBX6"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TBX6"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TBX6"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TBX6"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TBX6"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Misschien heeft u ook interesse in de volgende producten:



Referentie
Beschrijving
Cond.
Price Bef. VAT
OAAB03435
 400ul