TMTC1 Antibody - middle region : FITC

Referentie ARP49127_P050-FITC

Formaat : 100ul

Merk : Aviva Systems Biology

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

TMTC1 Antibody - middle region (ARP49127_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-TMTC1 (ARP49127_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TMTC1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Yeast: 91%
Peptide SequenceSynthetic peptide located within the following region: GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV
Concentration0.5 mg/ml
Blocking PeptideFor anti-TMTC1 (ARP49127_P050) antibody is Catalog # AAP49127 (Previous Catalog # AAPY02324)
ReferenceGerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Gene SymbolTMTC1
Gene Full NameTransmembrane and tetratricopeptide repeat containing 1
Alias SymbolsOLF, ARG99, TMTC1A
NCBI Gene Id83857
Protein NameTransmembrane and TPR repeat-containing protein 1
Description of TargetTMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown.
Uniprot IDQ8IUR5
Protein Accession #NP_787057
Nucleotide Accession #NM_175861
Protein Size (# AA)774
Molecular Weight87kDa