TMTC1 Antibody - middle region : FITC
Referentie ARP49127_P050-FITC
Formaat : 100ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
TMTC1 Antibody - middle region (ARP49127_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-TMTC1 (ARP49127_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TMTC1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Yeast: 91% |
| Peptide Sequence | Synthetic peptide located within the following region: GPEFADAYSSLASLLAEQERFKEAEEIYQTGIKNCPDSSDLHNNYGVFLV |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-TMTC1 (ARP49127_P050) antibody is Catalog # AAP49127 (Previous Catalog # AAPY02324) |
| Reference | Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
|---|---|
| Gene Symbol | TMTC1 |
| Gene Full Name | Transmembrane and tetratricopeptide repeat containing 1 |
| Alias Symbols | OLF, ARG99, TMTC1A |
| NCBI Gene Id | 83857 |
| Protein Name | Transmembrane and TPR repeat-containing protein 1 |
| Description of Target | TMTC1 is a multi-pass membrane protein. It belongs to the TMTC family and contains 10 TPR repeats. The exact function of TMTC1 remains unknown. |
| Uniprot ID | Q8IUR5 |
| Protein Accession # | NP_787057 |
| Nucleotide Accession # | NM_175861 |
| Protein Size (# AA) | 774 |
| Molecular Weight | 87kDa |
