C6orf201 Antibody - N-terminal region : Biotin

Referentie ARP41225_P050-Biotin

Formaat : 100ul

Merk : Aviva Systems Biology

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790
Datasheets/ManualsPrintable datasheet for anti-C6orf201 (ARP41225_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Yeast
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C6orf201
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Yeast: 91%
Peptide SequenceSynthetic peptide located within the following region: PFGMGLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSG
Concentration0.5 mg/ml
Blocking PeptideFor anti-C6orf201 (ARP41225_P050) antibody is Catalog # AAP41225 (Previous Catalog # AAPS01304)
Gene SymbolC6orf201
Gene Full NameChromosome 6 open reading frame 201
Alias SymbolsdJ1013A10.5
NCBI Gene Id404220
Protein NameUncharacterized protein C6orf201
Description of TargetThe specific function of C6orf201 is not yet known.
Uniprot IDQ7Z4U5
Protein Accession #AAH66986
Nucleotide Accession #NM_001085401
Protein Size (# AA)131
Molecular Weight14kDa
Protein InteractionsAPP;
  1. What is the species homology for "C6orf201 Antibody - N-terminal region (ARP41225_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Yeast".

  2. How long will it take to receive "C6orf201 Antibody - N-terminal region (ARP41225_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C6orf201 Antibody - N-terminal region (ARP41225_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C6orf201 Antibody - N-terminal region (ARP41225_P050)"?

    This target may also be called "dJ1013A10.5" in publications.

  5. What is the shipping cost for "C6orf201 Antibody - N-terminal region (ARP41225_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "C6orf201 Antibody - N-terminal region (ARP41225_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C6orf201 Antibody - N-terminal region (ARP41225_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "14kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C6orf201 Antibody - N-terminal region (ARP41225_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "C6ORF201"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "C6ORF201"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "C6ORF201"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "C6ORF201"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "C6ORF201"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "C6ORF201"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.