Clinisciences > CYP11B1 Antibody - C-terminal region
CYP11B1 Antibody - C-terminal region
Referentie ARP60140_P050-25UL
Formaat : 25ul
Merk : Aviva Systems Biology
Meer informatie aanvragen
Log alstublieft in om deze functie te gebruiken.
Datasheets/Manuals | Printable datasheet for anti-CYP11B1 (ARP60140_P050) antibody |
---|
Tested Species Reactivity | Human, Monkey | ||
---|---|---|---|
Predicted Species Reactivity | Human, Pig, Sheep, Monkey | ||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
Clonality | Polyclonal | ||
Host | Rabbit | ||
Application | IHC, WB | ||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human CYP11B1 | ||
Purification | Affinity Purified | ||
Predicted Homology Based on Immunogen Sequence | Human: 100%; Pig: 79%; Sheep: 79% | ||
Peptide Sequence | Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL | ||
Concentration | 0.5 mg/ml | ||
Blocking Peptide | For anti-CYP11B1 (ARP60140_P050) antibody is Catalog # AAP60140 (Previous Catalog # AAPP46274) | ||
Enhanced Validation |
|
Gene Symbol | CYP11B1 |
---|---|
Gene Full Name | Cytochrome P450, family 11, subfamily B, polypeptide 1 |
Alias Symbols | FHI, CPN1, CYP11B, P450C11 |
NCBI Gene Id | 1584 |
Protein Name | Cytochrome P450 11B1, mitochondrial |
Description of Target | This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the mitochondrial inner membrane and is involved in the conversion of progesterone to cortisol in the adrenal cortex. Mutations in this gene cause congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency. Transcript variants encoding different isoforms have been noted for this gene. |
Uniprot ID | P15538 |
Protein Accession # | NP_000488 |
Nucleotide Accession # | NM_000497 |
Protein Size (# AA) | 503 |
Molecular Weight | 58 kDa |
Protein Interactions | CYP11B2; |
Protein interactions
Name | # of Products |
---|---|
CYP11B2 | 8 |
Biological pathways
Name | # of Products |
---|---|
Aldosterone biosynthetic process | 5 |
Cellular response to hormone stimulus | 15 |
Cellular response to potassium ion | 5 |
Cortisol biosynthetic process | 5 |
Glucose homeostasis | 196 |
Immune response | 1416 |
Regulation of blood pressure | 94 |
Response to stress | 135 |
Xenobiotic metabolic process | 293 |
Biological process
Name | # of Products |
---|---|
Aldosterone biosynthetic process | 4 |
C21-steroid hormone biosynthetic process | 11 |
Cellular response to hormone stimulus | 35 |
Cellular response to potassium ion | 3 |
Cortisol biosynthetic process | 4 |
Glucocorticoid biosynthetic process | 8 |
Glucose homeostasis | 77 |
Immune response | 404 |
Mineralocorticoid biosynthetic process | 6 |
Oxidation-reduction process | 160 |
Regulation of blood pressure | 59 |
Response to stress | 160 |
Small molecule metabolic process | 825 |
Steroid metabolic process | 76 |
Xenobiotic metabolic process | 134 |
Cellular components
Name | # of Products |
---|---|
Membrane | 2769 |
Mitochondrial inner membrane | 251 |
Mitochondrion | 1154 |
Protein function
Name | # of Products |
---|---|
Electron carrier activity | 390 |
Heme binding | 327 |
Metal ion binding | 5514 |
Monooxygenase activity | 160 |
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | 102 |
Steroid 11-beta-monooxygenase activity | 5 |
Diseases
Name | # of Products |
---|---|
Congenital adrenal hyperplasia | 13 |
Disease mutation | 5332 |
- CYP11B1 Antibody - C-terminal region (OASG01961)Catalog #: OASG01961Application: ELISA, WBFormat: Liquid. 1 mg/mL in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide.Size: 100 uL
- CYP11B1 ELISA Kit (Rat) (OKCD01256)Catalog #: OKCD01256Application: ELISA-SandwichKit Range: 0.78-50ng/mLSensitivity: < 0.27 ng/mLSize: 96WELLS
- CYP11B1 Antibody - middle region (ARP60141_P050)Catalog #: ARP60141_P050Species Tested: HumanApplication: WBFormat: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.