GATA1 Antibody - N-terminal region : Biotin
Referentie P100834_P050-Biotin
Formaat : 100ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
GATA1 Antibody - N-terminal region (P100834_P050)
| Datasheets/Manuals | Printable datasheet for anti-GATA1 (P100834_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human GATA1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: SGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCME |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GATA1 (P100834_P050) antibody is Catalog # AAP31190 (Previous Catalog # AAPP01933) |
| Reference | de Gene 409 (1-2), 83-91 (2008) |
|---|---|
| Gene Symbol | GATA1 |
| Gene Full Name | GATA binding protein 1 (globin transcription factor 1) |
| Alias Symbols | GF1, GF-1, NFE1, XLTT, ERYF1, NF-E1, XLANP, XLTDA, GATA-1 |
| NCBI Gene Id | 2623 |
| Protein Name | Erythroid transcription factor |
| Description of Target | GATA1 is a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia.This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | P15976 |
| Protein Accession # | NP_002040 |
| Nucleotide Accession # | NM_002049 |
| Protein Size (# AA) | 413 |
| Molecular Weight | 43kDa |
| Protein Interactions | KRTAP10-5; CCDC24; HEXIM2; FBF1; KRTAP9-2; RADIL; FRS3; PRKAB2; HSPB1; HOXA1; AKT1; SPIB; SPI1; PRKAA1; HSPA4; FLI1; CASP3; SRA1; SUMO1; CEBPE; MAPK6; UBC; SKI; NME1; RAI1; ZBTB22; TRIM25; TAF7; TAX1BP3; ZZZ3; TRIM29; IKZF1; Rb1; ZFPM1; ZNF521; ZBTB16; HD |
