GCM1 Antibody - C-terminal region : FITC
Referentie P100837_P050-FITC
Formaat : 100ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
GCM1 Antibody - C-terminal region (P100837_P050)
| Datasheets/Manuals | Printable datasheet for anti-GCM1 (P100837_P050) antibody |
|---|
| Publications | Drewlo, S., Czikk, M., Baczyk, D., Lye, S. & Kingdom, J. Glial cell missing-1 mediates over-expression of tissue inhibitor of metalloproteinase-4 in severe pre-eclamptic placental villi. Hum. Reprod. 26, 1025-34 (2011). 21406447 |
|---|---|
| Tested Species Reactivity | Human |
| Predicted Species Reactivity | Human, Dog, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GCM1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Dog: 90%; Horse: 92%; Human: 100%; Rabbit: 81% |
| Peptide Sequence | Synthetic peptide located within the following region: DFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-GCM1 (P100837_P050) antibody is Catalog # AAP31193 (Previous Catalog # AAPP01936) |
| Reference | Chuang,H.C., et al., (2006) (er) Nucleic Acids Res. 34 (5), 1459-1469 |
|---|---|
| Gene Symbol | GCM1 |
| Gene Full Name | Glial cells missing homolog 1 (Drosophila) |
| Alias Symbols | GCMA, hGCMa |
| NCBI Gene Id | 8521 |
| Protein Name | Chorion-specific transcription factor GCMa |
| Description of Target | GCM1 is a DNA-binding protein with a gcm-motif (glial cell missing motif). GCM1 is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. |
| Uniprot ID | Q9NP62 |
| Protein Accession # | NP_003634 |
| Nucleotide Accession # | NM_003643 |
| Protein Size (# AA) | 436 |
| Molecular Weight | 49kDa |
| Protein Interactions | FBXW2; UBC; SENP1; CAMK1; SUMO1; DUSP23; CREBBP; HDAC5; HDAC4; HDAC3; HDAC1; CUL1; SKP1; UBE2I; |
