HOXD12 Antibody - middle region : HRP
Referentie ARP31967_P050-HRP
Formaat : 100ul
Merk : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-HOXD12 (ARP31967_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human HOXD12 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Goat: 93%; Guinea Pig: 100%; Horse: 79%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
Peptide Sequence | Synthetic peptide located within the following region: AGVASCLRPSLPDGLPWGAAPGRARKKRKPYTKQQIAELENEFLVNEFIN |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-HOXD12 (ARP31967_P050) antibody is Catalog # AAP31967 (Previous Catalog # AAPP02864) |
Reference | Zhao,X., (2007) Am. J. Hum. Genet. 80 (2), 361-371 |
---|---|
Gene Symbol | HOXD12 |
Gene Full Name | Homeobox D12 |
Alias Symbols | HOX4H |
NCBI Gene Id | 3238 |
Protein Name | Homeobox protein Hox-D12 |
Description of Target | HOXD12 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined. This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P35452 |
Protein Accession # | NP_067016 |
Nucleotide Accession # | NM_021193 |
Protein Size (# AA) | 270 |
Molecular Weight | 29kDa |
Protein Interactions | TRAF1; CREBBP; MAFF; MAFG; MEIS1; MAFB; MAFK; MAF; |