Low Molecular Weight Phosphotyrosine Protein Phosphatase, Recombinant, Human, aa1-158
Referentie 585220-20ug
Formaat : 20ug
Merk : US Biological
585220 Low Molecular Weight Phosphotyrosine Protein Phosphatase, Recombinant, Human, aa1-158
Clone Type
PolyclonalSwiss Prot
P24666Grade
PurifiedShipping Temp
Blue IceStorage Temp
-20°CActs on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. Isoform 3 does not possess phosphatase activity.||Source:|Recombinant protein corresponding to aa1-158 from human Low molecular weight phosphotyrosine protein phosphatase, expressed in E.coli.||Molecular Weight: |~18.0kD||Amino Acid Sequence:|MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH||Storage and Stability:|May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.