MYL3 Antibody - N-terminal region : FITC
Referentie ARP41381_P050-FITC
Formaat : 100ul
Merk : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-MYL3 (ARP41381_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MYL3 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 90%; Zebrafish: 79% |
Peptide Sequence | Synthetic peptide located within the following region: VEFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALG |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-MYL3 (ARP41381_P050) antibody is Catalog # AAP41381 |
Sample Type Confirmation | MYL3 is supported by BioGPS gene expression data to be expressed in COLO205 |
Reference | Bos,J.M., (2008) Am. Heart J. 155 (6), 1128-1134 |
---|---|
Gene Symbol | MYL3 |
Gene Full Name | Myosin, light chain 3, alkali; ventricular, skeletal, slow |
Alias Symbols | CMH8, VLC1, VLCl, MLC1V, MLC1SB, MLC-lV/sb |
NCBI Gene Id | 4634 |
Protein Name | Myosin light chain 3 |
Description of Target | MYL3 encodes myosin light chain 3, an alkali light chain also referred to in the literature as both the ventricular isoform and the slow skeletal muscle isoform. Mutations in MYL3 have been identified as a cause of mid-left ventricular chamber type hypert |
Uniprot ID | Q5R887 |
Protein Accession # | NP_000249 |
Nucleotide Accession # | NM_000258 |
Protein Size (# AA) | 195 |
Molecular Weight | 22kDa |
Protein Interactions | UBC; ATG101; FTH1; SP1; YWHAQ; CASP3; |