PAX2 Antibody - middle region : FITC
Referentie P100859_P050-FITC
Formaat : 100ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
PAX2 Antibody - middle region (P100859_P050)
| Datasheets/Manuals | Printable datasheet for anti-PAX2 (P100859_P050) antibody |
|---|
| Tested Species Reactivity | Human | ||||||
|---|---|---|---|---|---|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Sheep, Zebrafish | ||||||
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||||||
| Clonality | Polyclonal | ||||||
| Host | Rabbit | ||||||
| Application | IHC, WB | ||||||
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||||||
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PAX2 | ||||||
| Purification | Affinity Purified | ||||||
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100% | ||||||
| Peptide Sequence | Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR | ||||||
| Concentration | 0.5 mg/ml | ||||||
| Blocking Peptide | For anti-PAX2 (P100859_P050) antibody is Catalog # AAP31220 | ||||||
| Enhanced Validation |
|
| Reference | Bacchetta,J., (2008) Kidney Int. 73 (8), 977-978 |
|---|---|
| Gene Symbol | PAX2 |
| Gene Full Name | Paired box 2 |
| Alias Symbols | FSGS7, PAPRS |
| NCBI Gene Id | 5076 |
| Protein Name | Paired box protein Pax-2 |
| Description of Target | PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. PAX2 encodes paired box gene 2, one of many human homologues of the Drosophila melanogaster gene prd. The central feature of this transcription factor gene family is the conserved DNA-binding paired box domain. PAX2 is believed to be a target of transcriptional supression by the tumor supressor gene WT1. Mutations within PAX2 have been shown to result in optic nerve colobomas and renal hypoplasia. Alternative splicing of this gene results in multiple transcript variants. |
| Uniprot ID | Q02962 |
| Protein Accession # | NP_000269 |
| Nucleotide Accession # | NM_000278 |
| Protein Size (# AA) | 417 |
| Molecular Weight | 45kDa |
| Protein Interactions | BBS7; BBS4; BBS2; BBS1; RB1; BRCA1; SFRP2; PAXIP1; WT1; MAPK8IP1; MAPK8; ID2; |
