PAX7 Antibody - C-terminal region
Referentie ARP32742_P050
Formaat : 100ul
Merk : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-PAX7 (ARP32742_P050) antibody |
---|
Publications | A collagen domain-derived short adiponectin peptide activates APPL1 and AMPK signaling pathways and improves glucose and fatty acid metabolisms. J Biol Chem. 293, 13509-13523 (2018). 299915921 interacts with TWEAK to regulate tissue regeneration after ischaemic injury. Nat Commun. 6, 7792 (2015). 262427461$s> Cell cycle regulation of embryonic stem cells and mouse embryonic fibroblasts lacking functional Pax7. Cell Cycle. 15, 2931-2942 (2016). 276109331, 4536-48 (2012). 23136394115). 263592391$s> |
---|---|
Tested Species Reactivity | Human |
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | IHC, WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of PAX7 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
Peptide Sequence | Synthetic peptide located within the following region: QADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-PAX7 (ARP32742_P050) antibody is Catalog # AAP32742 |
Gene Symbol | PAX7 |
---|---|
Gene Full Name | Paired box 7 |
Alias Symbols | HUP1, RMS2, PAX7B, MYOSCO |
NCBI Gene Id | 5081 |
Protein Name | Paired box protein Pax-7 |
Description of Target | PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box gene 7 is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown. |
Uniprot ID | P23759 |
Protein Accession # | NP_002575 |
Nucleotide Accession # | NM_002584 |
Protein Size (# AA) | 520 |
Molecular Weight | 57kDa |
Protein Interactions | TRIM27; MYOD1; Dlg4; WDR5; ASH2L; HIRA; Ubc; |