Placental lactogen (CSH2) (NM_022644) Human Tagged ORF Clone

Referentie RC219345

Formaat : 10ug

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer :

Placental lactogen (CSH2) (NM_022644) Human Tagged ORF Clone

SKU
RC219345
CSH2 (Myc-DDK-tagged)-Human chorionic somatomammotropin hormone 2 (CSH2), transcript variant 2

Protein expression verified by Western blot, fully sequenced and in stock

Click here to learn more.

Bulk Requests & Clone Modifications
Specifications
Product Data
Target Symbol Placental lactogen
Synonyms CS-2; CSB; GHB1; hCS-B; PL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219345 representing NM_022644
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCAGGCTCCCGGACGTCCCTGCTCCTGGCTTTTGCCCTGCTCTGCCTGCCCTGGCTTCAAGAGG
CTGGTGCCGTCCAAACCGTTCCGTTATCCAGGCTTTTTGACCACGCTATGCTCCAAGCCCATCGCGCGCA
CCAGCTGGCCATTGACACCTACCAGGAGTTTGAAGAAACCTATATCCCAAAGGACCAGAAGTATTCATTC
CTGCATGACTCCCAGACCTCCTTCTGCTTCTCAGACTCTATTCCGACACCCTCCAACATGGAGGAAACGC
AACAGAAATCCAATCTAGAGCTGCTCCGCATCTCCCTGCTGCTCATCGAGTCGTGGCTGGAGCCCGTGCG
GTTCCTCAGGAGTATGTTCGCCAACAACCTGGTGTATGACACCTCGGACAGCGATGACTATCACCTCCTA
AAGGACCTAGAGGAAGGCATCCAAACGCTGATGGGGGTGAGGGTGGCGCCAGGGGTCACCAATCCTGGAA
CCCCACTGGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC219345 representing NM_022644
Red=Cloning site Green=Tags(s)

MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSF
LHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLL
KDLEEGIQTLMGVRVAPGVTNPGTPLA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_022644
ORF Size 501 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_022644.3
RefSeq Size 1134 bp
RefSeq ORF 504 bp
Locus ID 1443
Cytogenetics 17q23.3
Protein Families Secreted Protein
MW 18.6 kDa
Summary The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity. [provided by RefSeq, Jul 2008]