- More Files
- Specifications
Product Description
Mouse monoclonal antibody raised against partial recombinant human RBM3.
Immunogen
Recombinant protein corresponding to human RBM3.
Sequence
DEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNY
Host
Mouse
Reactivity
Human
Form
Liquid
Purification
Protein A purification
Isotype
IgG1
Recommend Usage
Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
Western Blot (1:500-1:1000)
The optimal working dilution should be determined by the end user.Storage Buffer
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Storage Instruction
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Applications
Western Blot (Cell lysate)
Western Blot analysis of RT-4 cell lysate with RBM3 monoclonal antibody, clone CL0296 (Cat # MAB15594).Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunohistochemical staining (Formalin-fixed paraffin-embedded sections) of human breast cancer with RBM3 monoclonal antibody, clone CL0296 (Cat # MAB15594) shows moderate nuclear positivity in tumor cells.Immunofluorescence
Immunofluorescent staining of U-2 OS cells with RBM3 monoclonal antibody, clone CL0296 (Cat # MAB15594) (Green) shows specific staining in the nucleoplasm. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). - Gene Info — RBM3
Entrez GeneID
5935Protein Accession#
P98179Gene Name
RBM3
Gene Alias
IS1-RNPL, RNPL
Gene Description
RNA binding motif (RNP1, RRM) protein 3
Omim ID
300027Gene Ontology
HyperlinkGene Summary
This gene is a member of the glycine-rich RNA-binding protein family and encodes a protein with one RNA recognition motif (RRM) domain. Expression of this gene is induced by cold shock and low oxygen tension. A pseudogene exists on chromosome 1. Multiple alternatively spliced transcript variants that are predicted to encode different isoforms have been characterized although some of these variants fit nonsense-mediated decay (NMD) criteria. [provided by RefSeq
Other Designations
OTTHUMP00000025800|OTTHUMP00000025802|RNA binding motif protein 3
- Interactomes
- Publication Reference
- Podocalyxin-like and RNA-binding motif protein 3 are prognostic biomarkers in urothelial bladder cancer: a validatory study.
Boman K, Andersson G, Wennersten C, Nodin B, Ahlgren G, Jirström K.
Biomarker Research 2017 Mar; 5:10.
- Evaluation of RNA-binding motif protein 3 expression in urothelial carcinoma of the bladder: an immunohistochemical study.
Florianova L, Xu B, Traboulsi S, Elmansi H, Tanguay S, Aprikian A, Kassouf W, Brimo F.
World Journal of Surgical Oncology 2015 Nov; 13:317.
Application:IHC, Human, Human urothelial carcinoma.
- Low RBM3 protein expression correlates with clinical stage, prognostic classification and increased risk of treatment failure in testicular non-seminomatous germ cell cancer.
Olofsson SE, Nodin B, Gaber A, Eberhard J, Uhlen M, Jirstrom K, Jerkeman M.
PLoS One 2015 Mar; 10(3):e0121300.
Application:IHC-P, Human, Human non-seminomatous germ cell cancer.
- Podocalyxin-like and RNA-binding motif protein 3 are prognostic biomarkers in urothelial bladder cancer: a validatory study.