SDF1 alpha antibody
Referentie GTX45117-100ug
Formaat : 100ug
Merk : GeneTex
Host | Rabbit |
---|---|
Clonality | Polyclonal |
Isotype | IgG |
Application | WB, IHC-P, IP, IHC |
Reactivity | Mouse, Rat |
Package | 100 μg |
View product citations for antibody GTX45117 on CiteAb
APPLICATION
Application Note
Recommended Starting Dilutions:
For WB: Use at a dilution of 1:1,000.
For IP: Use at a dilution of 1:300 - 1:500.
For IHC: Use at a dilution of 1:100 - 1:500.
Optimal dilutions/concentrations should be determined by the end user.
For WB: Use at a dilution of 1:1,000.
For IP: Use at a dilution of 1:300 - 1:500.
For IHC: Use at a dilution of 1:100 - 1:500.
Optimal dilutions/concentrations should be determined by the end user.
Calculated MW
11 kDa. ( Note )
Product Note
It recognizes both SDF-1 alpha and beta form of mouse and rat based on sequence homology
PROPERTIES
Form
Liquid
Buffer
PBS
Preservative
0.1% Sodium azide
Storage
Store as concentrated solution. Centrifuge briefly prior to opening vial. For short-term storage (1-2 weeks), store at 4ºC. For long-term storage, aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles.
Concentration
1 mg/ml (Please refer to the vial label for the specific concentration.)
Antigen Species
Mouse
Immunogen
Recombinant protein was generated using E. coli-expressed mouse SDF-1α as an immunogen.The sequence of mouse SDF-1 alpha antigen is DGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Purification
Protein A affinity purified
From polyclonal serum
From polyclonal serum
Conjugation
Unconjugated
RRID
AB_1080954
Note
For laboratory research use only. Not for any clinical, therapeutic, or diagnostic use in humans or animals. Not for animal or human consumption.
Purchasers shall not, and agree not to enable third parties to, analyze, copy, reverse engineer or otherwise attempt to determine the structure or sequence of the product.
Purchasers shall not, and agree not to enable third parties to, analyze, copy, reverse engineer or otherwise attempt to determine the structure or sequence of the product.
TARGET
Synonyms
chemokine (C-X-C motif) ligand 12 , Pbsf , Scyb12 , Sdf1 , Tlsf , Tpar1
Cellular Localization
Secreted
Background
This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]
Database
DATA IMAGES
GTX45117 WB ImageDetection of mouse recombinant SDF-1 alpha by Western blot |
Application Reference
Zhang Y et al. Acta Pharmacol Sin 2023; 44 (5) : 999-1013 GDF11 promotes wound healing in diabetic mice via stimulating HIF-1?-VEGF/SDF-1?-mediated endothelial progenitor cell mobilization and neovascularization.
Qin H et al. Evid Based Complement Alternat Med 2015; 2015 (Epub) : 385154 Effects of Astragaloside IV on the SDF-1/CXCR4 Expression in Atherosclerosis of apoE(-/-) Mice Induced by Hyperlipaemia.
Application : WB, IHC-P
Reactivity : Mouse
REVIEW
Application Reference
Zhang Y et al. Acta Pharmacol Sin 2023; 44 (5):999-1013 GDF11 promotes wound healing in diabetic mice via stimulating HIF-1?-VEGF/SDF-1?-mediated endothelial progenitor cell mobilization and neovascularization.
Qin H et al. Evid Based Complement Alternat Med 2015; 2015 (Epub):385154 Effects of Astragaloside IV on the SDF-1/CXCR4 Expression in Atherosclerosis of apoE(-/-) Mice Induced by Hyperlipaemia.
Application : WB, IHC-P
Reactivity : Mouse