TOMM40L Antibody - middle region

Referentie ARP35373_P050-25UL

Formaat : 25ul

Merk : Aviva Systems Biology

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-TOMM40L (ARP35373_P050) antibody
Product Info
ReferenceGregory,S.G., (2006) Nature 441 (7091), 315-321
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TOMM40L
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: LNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPD
Concentration0.5 mg/ml
Blocking PeptideFor anti-TOMM40L (ARP35373_P050) antibody is Catalog # AAP35373 (Previous Catalog # AAPP06611)
SubunitTOM40B
Gene SymbolTOMM40L
Gene Full NameTranslocase of outer mitochondrial membrane 40 homolog (yeast)-like
Alias SymbolsTOMM40B
NCBI Gene Id84134
Protein NameMitochondrial import receptor subunit TOM40B
Description of TargetTOMM40L is a potential channel-forming protein implicated in import of protein precursors into mitochondria.
Uniprot IDQ969M1
Protein Accession #NP_115550
Nucleotide Accession #NM_032174
Protein Size (# AA)308
Molecular Weight34kDa
Protein InteractionsRAB1B;
  1. What is the species homology for "TOMM40L Antibody - middle region (ARP35373_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "TOMM40L Antibody - middle region (ARP35373_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TOMM40L Antibody - middle region (ARP35373_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TOMM40L Antibody - middle region (ARP35373_P050)"?

    This target may also be called "TOMM40B" in publications.

  5. What is the shipping cost for "TOMM40L Antibody - middle region (ARP35373_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "TOMM40L Antibody - middle region (ARP35373_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TOMM40L Antibody - middle region (ARP35373_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TOMM40L Antibody - middle region (ARP35373_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TOMM40L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TOMM40L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TOMM40L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TOMM40L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TOMM40L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TOMM40L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Misschien heeft u ook interesse in de volgende producten:



Referentie
Beschrijving
Cond.
Price Bef. VAT
10-4577-10mg
 10mg 
MBS9208549-0,08mL
 0.08mL