UTS2D antibody
Referentie orb585257-100ul
Formaat : 100ul
Merk : Biorbyt
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
UTS2D antibody
Catalog Number: orb585257
| Catalog Number | orb585257 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to UTS2D |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Mouse |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 13kDa |
| Target | UTS2B |
| UniProt ID | Q765I0 |
| Protein Sequence | Synthetic peptide located within the following region: ALPNKLEELNQLEKLKEQLVEEKDSETSYAVDGLFSSHPSKRACFWKYCV |
| NCBI | NP_937795 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | U2B, URP, UIIB, U-IIB, UTS2D |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-UTS2D Antibody, Titration: 1.0 ug/ml, Positive Control: 721_B Whole Cell.