ALAD Antibody - N-terminal region : HRP
Referentie ARP41655_P050-HRP
Formaat : 100ul
Merk : Aviva Systems Biology
ALAD Antibody - N-terminal region (ARP41655_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/Manuals | Printable datasheet for anti-ALAD (ARP41655_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human ALAD |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 77%; Zebrafish: 83% |
Peptide Sequence | Synthetic peptide located within the following region: QPQSVLHSGYFHPLLRAWQTATTTLNASNLIYPIFVTDVPDDIQPITSLP |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-ALAD (ARP41655_P050) antibody is Catalog # AAP41655 (Previous Catalog # AAPS10011) |
Reference | Yen,P.H., (er) Am. J. Hum. Biol. (2008) In press |
---|---|
Gene Symbol | ALAD |
Gene Full Name | Aminolevulinate dehydratase |
Alias Symbols | PBGS, ALADH |
NCBI Gene Id | 210 |
Protein Name | Delta-aminolevulinic acid dehydratase |
Description of Target | The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway; zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | P13716 |
Protein Accession # | NP_000022 |
Nucleotide Accession # | NM_000031 |
Protein Size (# AA) | 339 |
Molecular Weight | 37kDa |
Protein Interactions | C14orf142; P3H1; RPRD1B; PPME1; LAP3; DBNL; HSPBP1; GPN1; WDR4; ACTR2; TOM1L1; ZPR1; OGT; SURF2; LPP; AGFG1; UBD; UBC; ALAD; |