CSF1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
- More Files
- Specifications
Product Description
Human CSF1 partial ORF ( AAH21117, 33 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — CSF1
Entrez GeneID
1435GeneBank Accession#
BC021117Protein Accession#
AAH21117Gene Name
CSF1
Gene Alias
MCSF, MGC31930
Gene Description
colony stimulating factor 1 (macrophage)
Omim ID
120420Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000013362|OTTHUMP00000013363|OTTHUMP00000013364|colony stimulating factor 1|macrophage colony stimulating factor
- Interactomes
- Pathways
- Diseases