En1/Hu-En-1
Referentie P100923_P050
Formaat : 100ul
Merk : Aviva Systems Biology
Datasheets/Manuals | Printable datasheet for anti-EN1 (P100923_P050) antibody |
---|
Publications | Beltran, A. S., Graves, L. M. & Blancafort, P. Novel role of Engrailed 1 as a prosurvival transcription factor in basal-like breast cancer and engineering of interference peptides block its oncogenic function. Oncogene. doi:10.1038/onc.2013.422 (2013). 241417791$s> |
---|---|
Tested Species Reactivity | Human |
Predicted Species Reactivity | Guinea Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human EN1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Guinea Pig: 93%; Rabbit: 86% |
Peptide Sequence | Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-EN1 (P100923_P050) antibody is Catalog # AAP31276 (Previous Catalog # AAPP02025) |
Reference | Atit,R., (2006) Dev. Biol. 296 (1), 164-176 |
---|---|
Gene Symbol | EN1 |
Gene Full Name | Engrailed homeobox 1 |
Alias Symbols | ENDOVESLB |
NCBI Gene Id | 2019 |
Protein Name | Homeobox protein engrailed-1 |
Description of Target | Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Uniprot ID | Q05925 |
Protein Accession # | NP_001417 |
Nucleotide Accession # | NM_001426 |
Protein Size (# AA) | 392 |
Molecular Weight | 40kDa |
Protein Interactions | TLE1; PAX6; JUN; |