OPCA02224-1MG | lepB Recombinant Protein Clinisciences

Datasheets/Manuals	Printable datasheet for LEPB Recombinant Protein (Mycobacterium tuberculosis) (OPCA02224) (OPCA02224)

Product Info
Predicted Species Reactivity	Mycobacterium tuberculosis
Product Format	Liquid or Lyophilized powder
Host	Mycobacterium tuberculosis
Reconstitution and Storage	-20°C or -80°C
Formulation	20 mM Tris-HCl based buffer, pH 8.0
Purity	Greater than 90% as determined by SDS-PAGE.
Peptide Sequence	RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR
Protein Sequence	RPYLIPSESMEPTLHGCSTCVGDRIMVDKLSYRFGSPQPGDVIVFRGPPSWNVGYKSIRSHNVAVRWVQNALSFIGFVPPDENDLVKRVIAVGGQTVQCRSDTGLTVNGRPLKEPYLDPATMMADPSIYPCLGSEFGPVTVPPGRVWVMGDNRTHSADSRAHCPLLCTDDPLPGTVPVANVIGKARLIVWPPSRWGVVRSVNPQQGR
Storage Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source	E.coli
Protein Range	88-294 aa
Tag	N-terminal 6xHis-SUMO-tagged

Reference	Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry.Kelkar D.S., Kumar D., Kumar P., Balakrishnan L., Muthusamy B., Yadav A.K., Shrivastava P., Marimuthu A., Anand S., Sundaram H., Kingsbury R., Harsha H.C., Nair B., Prasad T.S., Chauhan D.S., Katoch K., Katoch V.M., Kumar P. , Chaerkady R., Ramachandran S., Dash D., Pandey A.Mol. Cell. Proteomics 10:M111.011627-M111.011627(2011)
Gene Symbol	lepB
Gene Full Name	signal peptidase
Alias Symbols	Leader peptidase I;Rv2903c;signal peptidase.
NCBI Gene Id	887157
Protein Name	Signal peptidase I
Uniprot ID	P9WKA1
Protein Accession #	NP_217419.1
Nucleotide Accession #	NC_000962.3
Protein Size (# AA)	Recombinant
Molecular Weight	38.6 kDa

lepB Recombinant Protein