NR2F2 Antibody - N-terminal region : Biotin

Referentie P100816_P050-Biotin

Formaat : 100ul

Merk : Aviva Systems Biology

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

NR2F2 Antibody - N-terminal region (P100816_P050)

Datasheets/ManualsPrintable datasheet for anti-NR2F2 (P100816_P050) antibody
Product Info
Publications

Déjardin, J. & Kingston, R. E. Purification of proteins associated with specific genomic Loci. Cell 136, 175-86 (2009). 19135898

More...

Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Pig, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human NR2F2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 92%; Zebrafish: 92%
Peptide SequenceSynthetic peptide located within the following region: KVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEP
Concentration0.5 mg/ml
Blocking PeptideFor anti-NR2F2 (P100816_P050) antibody is Catalog # AAP31163 (Previous Catalog # AAPS22105)
Sample Type Confirmation

NR2F2 is supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceSato,Y., (2003) J. Clin. Endocrinol. Metab. 88 (7), 3415-3420
Gene SymbolNR2F2
Gene Full NameNuclear receptor subfamily 2, group F, member 2
Alias SymbolsARP1, ARP-1, CHTD4, NF-E3, SRXX5, SVP40, COUPTF2, COUPTFB, TFCOUP2, COUPTFII
NCBI Gene Id7026
Protein NameCOUP transcription factor 2
Description of TargetNR2F2, an orphan member of the nuclear hormone receptor superfamily, acts as a transcriptional repressor by antagonizing the functions of other nuclear hormone receptors and by actively silencing transcription. However, in certain contexts, NR2F2 stimulates transcription directly. NR2F2, MyoD and p300 interact in a competitive manner, and that increasing amounts of NR2F2 have the ability to reduce the interaction between myoD and p300 invitro. NR2F2 post-transcriptionally regulates myoD activity/function, and that crosstalk between orphan nuclear receptors and the myogenic bHLH proteins has functional consequences for differentiation.
Uniprot IDP24468
Protein Accession #NP_066285
Nucleotide Accession #NM_021005
Protein Size (# AA)414
Molecular Weight45kDa
Protein InteractionsNSD1; BCL11A; NR2F2; BIK; SETD7; FAM46A; HIPK3; UBC; TFAP4; Cebpb; SMARCAD1; NR2F6; POU5F1; NR3C1; PHB2; TRIP4; PIAS1; BCL11B; TRIM24; EP300; SQSTM1; HDAC1; NCOR2; MYOD1; LCK;