OS9 antibody
Referentie orb579264-100ul
Formaat : 100ul
Merk : Biorbyt
OS9 antibody
Catalog Number: orb579264
Catalog Number | orb579264 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to OS9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat |
Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human OS9 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 73kDa |
Target | OS9 |
UniProt ID | Q13438 |
Protein Sequence | Synthetic peptide located within the following region: LKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPGGEGTGDLDEFDF |
NCBI | NP_006803 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | OS-9, ERLEC2 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Host: Rabbit, Target Name: OS9, Sample Type: Lung Tumor lysates, Antibody Dilution: 1.0 ug/ml.