SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1) (MaxLight 490)

Referentie 132993-ML490-100ul

Formaat : 100ul

Merk : US Biological

Meer informatie aanvragen

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790


132993-ML490 SCARA3 (Scavenger Receptor Class A Member 3, Cellular Stress Response Gene Protein , CSR, CSR1, APC7, MSLR1, MSRL1) (MaxLight 490)

Clone Type
Polyclonal
Host
mouse
Source
human
Isotype
IgG2a,k
Grade
Affinity Purified
Applications
FLISA WB
Crossreactivity
Hu Mo Rt
Accession #
NM_016240, NP_057324
Shipping Temp
Blue Ice
Storage Temp
4°C Do Not Freeze

MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.||Applications:|Suitable for use in FLISA and Western Blot. Other applications not tested.||Recommended Dilution:|Optimal dilutions to be determined by the researcher.||AA Sequence:|SFLDDHEENMHDLQYHTHYAQNRTVERFESLEGRMASHEIEIGTIFTNINATDNHVHSMLKYLDDVRLSCTLGFHTHAEELYYLNKSVSIMLGTTDLLRE||Storage and Stability:|Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.||Note: Applications are based on unconjugated antibody.

Applications
Product Type: Mab|Isotype: IgG2a,k|Clone No: 3A2|Host: mouse|Source: human|Concentration: As reported|Form: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.|Purity: Purified by Protein A affinity chromatography.|Immunogen: Partial recombinant corresponding to aa316-416 from human SCARA3 (NP_057324) with GST tag. MW of the GST tag alone is 26kD.|Specificity: Recognizes human SCARA3. Species Crossreactivity: mouse and rat.||Important Note: This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Immunogen
Partial recombinant corresponding to aa316-416 from human SCARA3 (NP_057324) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SCARA3. Species Crossreactivity: mouse and rat.