CRBN Antibody - N-terminal region : HRP
Référence ARP56882_P050-HRP
Conditionnement : 100ul
Marque : Aviva Systems Biology
CRBN Antibody - N-terminal region (ARP56882_P050)
Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/Manuals | Printable datasheet for anti-CRBN (ARP56882_P050) antibody |
---|
Publications | HDAC6â, 499-512 (2019). 312681561, 233-44 (2014). 242060171$s> | ||
---|---|---|---|
Tested Species Reactivity | Human | ||
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish | ||
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. | ||
Clonality | Polyclonal | ||
Host | Rabbit | ||
Application | WB | ||
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. | ||
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CRBN | ||
Purification | Affinity Purified | ||
Predicted Homology Based on Immunogen Sequence | Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% | ||
Peptide Sequence | Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL | ||
Concentration | 0.5 mg/ml | ||
Blocking Peptide | For anti-CRBN (ARP56882_P050) antibody is Catalog # AAP56882 (Previous Catalog # AAPP39828) | ||
Enhanced Validation |
|
Reference | 0 |
---|---|
Gene Symbol | CRBN |
Gene Full Name | Cereblon |
Alias Symbols | MRT2, MRT2A |
NCBI Gene Id | 51185 |
Protein Name | Protein cereblon |
Description of Target | This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutatio |
Uniprot ID | Q96SW2 |
Protein Accession # | NP_057386 |
Nucleotide Accession # | NM_016302 |
Protein Size (# AA) | 442 |
Molecular Weight | 50 kDa |
Protein Interactions | PAK7; RBPMS; MEIS2; DDB1; IKZF3; IKZF1; SUV39H1; KDM1A; UBC; COPS4; COPS6; COPS3; PSMB4; PSMA2; COPS5; CUL4A; PRKAA1; RBX1; |