CSF2 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
- More Files
- Specifications
Product Description
Human CSF2 full-length ORF ( AAI14000.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
42.7
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
- Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
- Gene Info — CSF2
Entrez GeneID
1437GeneBank Accession#
BC113999.1Protein Accession#
AAI14000.1Gene Name
CSF2
Gene Alias
GMCSF, MGC131935, MGC138897
Gene Description
colony stimulating factor 2 (granulocyte-macrophage)
Omim ID
138960Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes and macrophages. The active form of the protein is found extracellularly as a homodimer. This gene has been localized to a cluster of related genes at chromosome region 5q31, which is known to be associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include those encoding interleukins 4, 5, and 13. [provided by RefSeq
Other Designations
colony stimulating factor 2|granulocyte-macrophage colony stimulating factor|molgramostin|sargramostim
- Interactomes
- Pathways
- Diseases