Lixisenatide [320367-13-3]
Référence HY-P0119-1mg
Conditionnement : 1mg
Marque : MedChemExpress
Lixisenatide is a GLP-1 receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of proinflammatory cytokines, and blocks of cellular signaling pathways. Lixisenatide decreases atheroma plaque size and instability in Apoe−/− Irs2+/− mice by reprogramming macrophages towards an M2 phenotype, which leads to reduced inflammation.
Nos produits utilisent uniquement pour la recherche. Nous ne vendons pas aux patients.
Synthèse de peptides personnalisée
Lixisenatide Chemical Structure
CAS No. : 320367-13-3
This product is a controlled substance and not for sale in your territory.
Based on 1 publication(s) in Google Scholar
Other Forms of Lixisenatide:
- Lixisenatide acetate In-stock
Voir tous les produits spécifiques à Isoform MEK:
Voir tous les produits spécifiques à Isoform Akt:
Voir tous les produits spécifiques à Isoform MMP:
Voir tous les produits spécifiques à Isoform JNK:
Description |
Lixisenatide is a GLP-1 receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of proinflammatory cytokines, and blocks of cellular signaling pathways. Lixisenatide decreases atheroma plaque size and instability in Apoe−/− Irs2+/− mice by reprogramming macrophages towards an M2 phenotype, which leads to reduced inflammation[2][3][5]. |
||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
IC50 & Target |
|
||||||||||||||||
In Vitro |
Lixisenatide (100 μM, 24 h) inhibits the Aβ25-35-induced cytotoxicity on cultured hippocampal cells. [1]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only. Cell Viability Assay[1]
Western Blot Analysis[3]
|
||||||||||||||||
In Vivo |
Lixisenatide (10 μg/kg, Subcutaneous injection, once a day for a month) diminishes the atherosclerosis burden and produces more stable plaques [2]. MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.
|
||||||||||||||||
Essai clinique |
|
||||||||||||||||
Masse moléculaire |
4858.49 |
||||||||||||||||
Formule |
C215H347N61O65S |
||||||||||||||||
CAS No. |
320367-13-3 |
||||||||||||||||
Appearance |
Solid |
||||||||||||||||
Color |
White to pink |
||||||||||||||||
Sequence |
His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Ser-Lys-Lys-Lys-Lys-Lys-Lys-NH2 |
||||||||||||||||
Sequence Shortening |
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2 |
||||||||||||||||
Livraison | Room temperature in continental US; may vary elsewhere. |
||||||||||||||||
Stockage |
Sealed storage, away from moisture
*In solvent : -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture) |
||||||||||||||||
Solvant et solubilité |
In Vitro:
H2O : 100 mg/mL (20.58 mM; Need ultrasonic) Preparing
Stock Solutions
View the Complete Stock Solution Preparation Table
*
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles. * Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol) Concentration (start) × Volume (start) = Concentration (final) × Volume (final) This equation is commonly abbreviated as: C1V1 = C2V2 In Vivo Dissolution Calculator
Please enter the basic information of animal experiments:
Dosage mg/kgAnimal weight Dosing volume Number of animals Recommended: Prepare an additional quantity of animals to account for potential losses during experiments.
Calculation results:
Working solution concentration:
mg/mL
This product has good water solubility, please refer to the measured solubility data in water/PBS/Saline for details.
The concentration of the stock solution you require exceeds the measured solubility. The following solution is for reference only.If necessary, please contact MedChemExpress (MCE).
|
||||||||||||||||
Pureté et documentation | |||||||||||||||||
Références |
|
Complete Stock Solution Preparation Table
*
Please refer to the solubility information to select the appropriate solvent. Once prepared, please aliquot and store the solution to prevent product inactivation from repeated freeze-thaw cycles.
Storage method and period of stock solution: -80°C, 6 months; -20°C, 1 month (sealed storage, away from moisture). When stored at -80°C, please use it within 6 months. When stored at -20°C, please use it within 1 month.
Optional Solvent | Concentration Solvent Mass | 1 mg | 5 mg | 10 mg | 25 mg |
---|
H2O | 1 mM | 0.2058 mL | 1.0291 mL | 2.0583 mL | 5.1456 mL |
5 mM | 0.0412 mL | 0.2058 mL | 0.4117 mL | 1.0291 mL | |
10 mM | 0.0206 mL | 0.1029 mL | 0.2058 mL | 0.5146 mL | |
15 mM | 0.0137 mL | 0.0686 mL | 0.1372 mL | 0.3430 mL | |
20 mM | 0.0103 mL | 0.0515 mL | 0.1029 mL | 0.2573 mL |
* Note: If you choose water as the stock solution, please dilute it to the working solution, then filter and sterilize it with a 0.22 μm filter before use.
Lixisenatide Related Classifications
- Neurological Disease Metabolic Disease Inflammation/Immunology
- GPCR/G Protein MAPK/ERK Pathway PI3K/Akt/mTOR Metabolic Enzyme/Protease
- GCGR MEK Akt MMP JNK